PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2902s0164.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 556aa    MW: 62193.3 Da    PI: 8.2708
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2902s0164.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573113.31.5e-3565161298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +++r+w+eeDe+++L+Gl+d++aktg + +  +dafy+fv +si++kvsk+ql++Kir+LKkKf  +++k+++g++p+f++++d+++f++
  Bostr.2902s0164.1.p  65 MSNRIWNEEDELAILKGLVDYRAKTGFQTKIVCDAFYRFVGGSIHVKVSKDQLLSKIRKLKKKFLVHMEKINQGNDPHFTRSSDSEAFGY 154
                          689*************************************************************************************** PP

               DUF573  92 skkiWgs 98 
                          s++iWg+
  Bostr.2902s0164.1.p 155 SMMIWGK 161
                          *****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-2667160IPR007592Protein of unknown function DUF573
SMARTSM007242.9E-43339544IPR006634TRAM/LAG1/CLN8 homology domain
PROSITE profilePS509229.382339544IPR006634TRAM/LAG1/CLN8 homology domain
PfamPF037981.1E-13346536IPR006634TRAM/LAG1/CLN8 homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MATPTQLDFS SPRGGDDSDD ISPSSPSLSR RRKPASKRDA SETVSEEETK TKKKNKVKNK  60
LASPMSNRIW NEEDELAILK GLVDYRAKTG FQTKIVCDAF YRFVGGSIHV KVSKDQLLSK  120
IRKLKKKFLV HMEKINQGND PHFTRSSDSE AFGYSMMIWG KTDAEFANGG MDKAHQSETE  180
EEMFKKDEEL TLIDNGAAKS DFDGKSHHEA IVVEKITTEN GTAGKENDNN DDDELCAVQD  240
AFETMMSQGL SDYQKKLHVK KLMNLGTEKI RELSNEWKAL CVEENSSSSS SIVAGIEIPI  300
SMSISIGKIS IPDLPLFFSM FLTIYLIAYF IVFRNWKPQI RPEASSCLIS IFHGTPAVFL  360
ATRAVFSSSS RSFSSANTAA QNTVLDFSVA YFLTDLVHYI VFNPNDVLFI GHHLATLFVF  420
VTCRFLVFHG ACAILGLLIL AEVTSACQNA WTLAGARKND PESRLAVKVY DLLSPPFYAF  480
YSIVRGVLGP LFFGKMVAFY ARGGAHGVIP NWLWISWAIV VGTAITVSIL WIWNLWIELF  540
RERKANKLRQ DKKLR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1175480.0AK117548.1 Arabidopsis thaliana At5g14280 mRNA for unknown protein, complete cds, clone: RAFL17-19-N04.
GenBankAL1638170.0AL163817.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F18O22 (ESSA project).
GenBankAY0756160.0AY075616.1 Arabidopsis thaliana AT5g14280/F18O22_70 mRNA sequence.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492230.10.0PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104769663
TrEMBLD7M6220.0D7M622_ARALL; Predicted protein
STRINGAl_scaffold_0006_13290.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM187655
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14280.10.0DNA-binding storekeeper protein-related